Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFV1 Peptide - middle region

NDUFV1 Peptide - middle region

Product Specifications

Product Name Alternative

CI-51kD

UniProt

Q91YT0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598427.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAH2 Antibody
KC-27942-01 50 μL

ASAH2 Antibody

Sign In for Pricing
View Details
ASAH2 Antibody
KC-27942-02 100 µL

ASAH2 Antibody

Sign In for Pricing
View Details
ASAH2 Antibody
KC-27942-03 1 mL

ASAH2 Antibody

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), Biotin conjugate, 0.1mg/mL
BNCB1729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GI24 (C10orf54) Mouse Monoclonal Antibody [Clone ID: OTI6E5]
CF812251 100 µg

GI24 (C10orf54) Mouse Monoclonal Antibody [Clone ID: OTI6E5]

Sign In for Pricing
View Details
Lactacystin
SIH-327-200UG 200 µg

Lactacystin

Sign In for Pricing
View Details