Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHB2 Peptide - middle region

PHB2 Peptide - middle region

Product Specifications

Product Name Alternative

BAP, REA, Bap37, Bcap37, AU044498

UniProt

O35129

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031557.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCOR3 Polyclonal Antibody
MBS2562854-01 0.02 mL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
MBS2562854-02 0.06 mL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
MBS2562854-03 0.12 mL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
MBS2562854-04 0.2 mL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
MBS2562854-05 5x 0.2 mL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SLC25A28 shRNA (UAS) - Lentiviral human SLC25A28 shRNA (UAS, RFP) plasmid
GTR15139189 1 Vial

Lentiviral human SLC25A28 shRNA (UAS) - Lentiviral human SLC25A28 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details