PHB2 Peptide - middle region
PHB2 Peptide - middle region
Product Specifications
Product Name Alternative
BAP, REA, Bap37, Bcap37, AU044498
UniProt
O35129
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031557.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6850-01A-ML490 100 µL
KSR (Kinase Suppressor of Ras, KSR1, BKSR1, dKsr, EK31, hb, Positive Ras Signaling Mediator Family Member, RSU2, Suppressor of Activated let 60 Ras SUR3, Suppressor of Ras1 31, SR31) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
135542-FITC 100 µL
ZEB2 (Zinc Finger E-box-binding Homeobox 2, HRIHFB2411, KIAA0569, Smad-interacting Protein 1, SMADIP1, SIP1, SIP-1, Zinc Finger Homeobox Protein 1b, ZFHX1B, ZFX1B, HSPC082) (FITC)
Sign In for Pricing
View Details 
D9800-02-01 10 L
Dulbecco’s MEM (DMEM) w/o Glucose, L-Glutamine (Powder)
Sign In for Pricing
View Details D9800-02-02 25 L
Dulbecco’s MEM (DMEM) w/o Glucose, L-Glutamine (Powder)
Sign In for Pricing
View Details D9800-02-03 50 L
Dulbecco’s MEM (DMEM) w/o Glucose, L-Glutamine (Powder)
Sign In for Pricing
View Details