ELOVL5 Peptide - middle region
ELOVL5 Peptide - middle region
Product Specifications
Product Name Alternative
HELO1, AI747313, AU043003, 1110059L23Rik
UniProt
Q8BHI7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_599016.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR205718L3V 200 µL
Tram2 (NM_133252) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS243084-01 0.05 mL
Rabbit Polyclonal (IgG) to Human SNCB / Beta-Synuclein
Sign In for Pricing
View Details