Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Peptide - middle region

ELOVL5 Peptide - middle region

Product Specifications

Product Name Alternative

HELO1, AI747313, AU043003, 1110059L23Rik

UniProt

Q8BHI7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_599016.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC9 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07565 0.1 mg

HOXC9 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
TBX6 (h) -PR
sc-106773-PR 10 µM - 20 µL

TBX6 (h) -PR

Sign In for Pricing
View Details
Lacnotuzumab (Anti-CSF1 / M-CSF)
A2534-1mg*5 5x 1mg

Lacnotuzumab (Anti-CSF1 / M-CSF)

Sign In for Pricing
View Details
Mouse nicotinamide adenine dinucleotide (NADH) ELISA Kit
NSL1084m 96 Tests

Mouse nicotinamide adenine dinucleotide (NADH) ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-1260b miRNA Antagomir
orb1915354-01 10 nmol

Hsa-miR-1260b miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1260b miRNA Antagomir
orb1915354-02 20 nmol

Hsa-miR-1260b miRNA Antagomir

Sign In for Pricing
View Details