Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF2 Peptide - middle region

CRLF2 Peptide - middle region

Product Specifications

Product Name Alternative

CRLM2, Ly114, Tpte2, Tslpr

UniProt

Q8CII9

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158207.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPCVPDPSGSFPGLFEKHHGNFQAWIADAQATAPPARTEEEDDLIHPKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-protein coupled Receptor 183 (GPR183) Mouse ELISA Kit
D5539 96 Tests

G-protein coupled Receptor 183 (GPR183) Mouse ELISA Kit

Sign In for Pricing
View Details
Nephrin
325553-01 50 µg

Nephrin

Sign In for Pricing
View Details
Nephrin
325553-02 100 µg

Nephrin

Sign In for Pricing
View Details
DDX25 discontinued
530497-01 20 µL

DDX25 discontinued

Sign In for Pricing
View Details
DDX25 discontinued
530497-02 100 µL

DDX25 discontinued

Sign In for Pricing
View Details
C5ar1 3'UTR Luciferase Stable Cell Line
TU102980 1.0 mL

C5ar1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details