Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPP6 Peptide - middle region

DPP6 Peptide - middle region

Product Specifications

Product Name Alternative

Rw, Dpp-6, Peplb, D5Buc3, D5Buc4, D5Buc5, DPP VI, Gm1377, In (5) 6H-p, B930011P16Rik

UniProt

Q9Z218

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034205.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NVP-QAV-572
BA8759-10 10 mg

NVP-QAV-572

Sign In for Pricing
View Details
Antiproliferative agent-66
orb2944898-01 10 mg

Antiproliferative agent-66

Sign In for Pricing
View Details
Antiproliferative agent-66
orb2944898-02 50 mg

Antiproliferative agent-66

Sign In for Pricing
View Details
Culture Vessel Fv 1Ltr 1000ml
QFV1L 1 Each

Culture Vessel Fv 1Ltr 1000ml

Sign In for Pricing
View Details
(S)-alpha-(2,4-dichloro-benzyl)-proline-HCl
MBS9024006-01 500 mg

(S)-alpha-(2,4-dichloro-benzyl)-proline-HCl

Sign In for Pricing
View Details
(S)-alpha-(2,4-dichloro-benzyl)-proline-HCl
MBS9024006-02 5x 500 mg

(S)-alpha-(2,4-dichloro-benzyl)-proline-HCl

Sign In for Pricing
View Details