DPP6 Peptide - middle region
DPP6 Peptide - middle region
Product Specifications
Product Name Alternative
Rw, Dpp-6, Peplb, D5Buc3, D5Buc4, D5Buc5, DPP VI, Gm1377, In (5) 6H-p, B930011P16Rik
UniProt
Q9Z218
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034205.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1155516-01 0.02 mg (E-Coli)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details MBS1155516-02 0.02 mg (Yeast)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details MBS1155516-03 0.1 mg (E-Coli)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details MBS1155516-04 0.1 mg (Yeast)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details MBS1155516-05 1 mg (E-Coli)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details MBS1155516-06 1 mg (Yeast)
Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Sign In for Pricing
View Details