Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAVCR1 Peptide - middle region

HAVCR1 Peptide - middle region

Product Specifications

Product Name Alternative

Tim1, KIM-1, TIM-1, Timd1, AI503787

UniProt

Q5QNS5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001160103.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRTC1 (DMRTC1B) (NM_001080851) Human Over-expression Lysate
LC421131 20 µg

DMRTC1 (DMRTC1B) (NM_001080851) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Amino-1-tert-butyl-3-(1’-naphthyl)pyrazolo[3,4-d]pyrimidine
TRC-A603004-5MG 5 mg

4-Amino-1-tert-butyl-3-(1’-naphthyl)pyrazolo[3,4-d]pyrimidine

Sign In for Pricing
View Details
PTBP1 Rabbit Polyclonal Antibody
TA380479 100 µL

PTBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BEX2 Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF811155 100 µg

BEX2 Mouse Monoclonal Antibody [Clone ID: OTI1H3]

Sign In for Pricing
View Details
TAAR3 Antibody
8G772-AAT 50 µg

TAAR3 Antibody

Sign In for Pricing
View Details
PPT1 (NM_001142604) Human Over-expression Lysate
LC428205 20 µg

PPT1 (NM_001142604) Human Over-expression Lysate

Sign In for Pricing
View Details