Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAVCR1 Peptide - middle region

HAVCR1 Peptide - middle region

Product Specifications

Product Name Alternative

Tim1, KIM-1, TIM-1, Timd1, AI503787

UniProt

Q5QNS5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001160103.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKVTFSLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS709537 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504936 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (PCK/3150), Biotin conjugate, 0.1mg/mL
BNCB3150-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (PCK/3150), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Snx15 Mouse Gene Knockout Kit (CRISPR)
KN516427 1 Kit

Snx15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IP6K2 Polyclonal Antibody
E-AB-19095-01 20 µL

IP6K2 Polyclonal Antibody

Sign In for Pricing
View Details
IP6K2 Polyclonal Antibody
E-AB-19095-02 60 µL

IP6K2 Polyclonal Antibody

Sign In for Pricing
View Details