Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD2 Peptide - N-terminal region

TEAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ETF, Etdf, TEF4, TEF-4, TEAD-2

UniProt

P48301

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272427.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVWSPDIEQSFQEALAIYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pde8b Pre-designed siRNA Set A
SI210231A 1 Each

Rat Pde8b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Kif26b shRNA (UAS) - Lentiviral mouseKif26b shRNA (UAS, GFP) (25)
GTR15230444 1 Vial

Lentiviral mouse Kif26b shRNA (UAS) - Lentiviral mouseKif26b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TSC22 Domain Family Protein 4 (TSC22D4) Antibody
abx239037 100 µg

TSC22 Domain Family Protein 4 (TSC22D4) Antibody

Sign In for Pricing
View Details
MAP4 Antibody
MBS7124353-01 0.05 mL

MAP4 Antibody

Sign In for Pricing
View Details
MAP4 Antibody
MBS7124353-02 0.1 mL

MAP4 Antibody

Sign In for Pricing
View Details
MAP4 Antibody
MBS7124353-03 5x 0.1 mL

MAP4 Antibody

Sign In for Pricing
View Details