Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD2 Peptide - N-terminal region

TEAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ETF, Etdf, TEF4, TEF-4, TEAD-2

UniProt

P48301

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272427.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVWSPDIEQSFQEALAIYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Exoc8 Pre-designed siRNA Set A
SI204659A 1 Each

Rat Exoc8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
KSR2 ELISA Kit (Human)
OKEH04713-96W 96 Well

KSR2 ELISA Kit (Human)

Sign In for Pricing
View Details
ELISA kit for Mouse HO2 (Heme Oxygenase 2)
E-EL-M0652 96 Tests

ELISA kit for Mouse HO2 (Heme Oxygenase 2)

Sign In for Pricing
View Details
Anti-GBE1 Antibody
A04694 100 µL

Anti-GBE1 Antibody

Sign In for Pricing
View Details
SYT17 Protein Lysate (Rat) with C-HA Tag
46002036 100 µg

SYT17 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
HOXB3 3'UTR Luciferase Stable Cell Line
TU010087 1.0 mL

HOXB3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details