MESP2 Peptide - middle region
MESP2 Peptide - middle region
Product Specifications
Product Name Alternative
BHLHc6
UniProt
P97309
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032615.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRTRPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTK
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10471206 96 Well
Mouse Wingless type MMTV integration site family, member 4 ELISA kit
Sign In for Pricing
View Details CK-bio-20593-01 48 Tests
Rat ADAM metallopeptidase with thrombospondin type 1 motif 5 (ADAMTS5) ELISA Kit
Sign In for Pricing
View Details CK-bio-20593-02 96 Tests
Rat ADAM metallopeptidase with thrombospondin type 1 motif 5 (ADAMTS5) ELISA Kit
Sign In for Pricing
View Details