Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MESP2 Peptide - middle region

MESP2 Peptide - middle region

Product Specifications

Product Name Alternative

BHLHc6

UniProt

P97309

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032615.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRTRPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein Barr Virus (EBV), gp250/350 (AP)
MBS6241676-01 0.1 mL

Epstein Barr Virus (EBV), gp250/350 (AP)

Sign In for Pricing
View Details
Epstein Barr Virus (EBV), gp250/350 (AP)
MBS6241676-02 5x 0.1 mL

Epstein Barr Virus (EBV), gp250/350 (AP)

Sign In for Pricing
View Details
LAMA3 Rabbit mAb
MBS9470143-01 0.05 mL

LAMA3 Rabbit mAb

Sign In for Pricing
View Details
LAMA3 Rabbit mAb
MBS9470143-02 0.1 mL

LAMA3 Rabbit mAb

Sign In for Pricing
View Details
LAMA3 Rabbit mAb
MBS9470143-03 5x 0.1 mL

LAMA3 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal Protein Phosphatase 1C gamma Antibody [Alexa Fluor 350]
NB110-40551AF350 0.1 mL

Rabbit Polyclonal Protein Phosphatase 1C gamma Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details