Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFA Peptide - middle region

ETFA Peptide - middle region

Product Specifications

Product Name Alternative

D9Ertd394e, 2010200I21Rik

UniProt

Q99LC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_663590.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVRGTSFEAAATSGGSASSEKAPSSSSVGISEWLDQKLTKSDRPELTGAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRRIQ4 Knockout HEK293T cell line
GTR15409943 1 Vial

Human LRRIQ4 Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)
MBS7040194-01 0.02 mg

Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)
MBS7040194-02 0.1 mg

Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)
MBS7040194-03 5x 0.1 mg

Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C688.09 (SPAC688.09)

Sign In for Pricing
View Details
Recombinant Rat Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3)
MBS1294519-01 0.02 mg (E-Coli)

Recombinant Rat Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3)

Sign In for Pricing
View Details
Recombinant Rat Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3)
MBS1294519-02 0.02 mg (Yeast)

Recombinant Rat Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3)

Sign In for Pricing
View Details