Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFA Peptide - middle region

ETFA Peptide - middle region

Product Specifications

Product Name Alternative

D9Ertd394e, 2010200I21Rik

UniProt

Q99LC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_663590.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVRGTSFEAAATSGGSASSEKAPSSSSVGISEWLDQKLTKSDRPELTGAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINK7 Protein Vector (Human) (pPM-C-HA)
PV058303 500 ng

SPINK7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibin Alpha (INHa)
TRV-0046091-01 20 µL

Polyclonal Antibody to Inhibin Alpha (INHa)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibin Alpha (INHa)
TRV-0046091-02 100 µL

Polyclonal Antibody to Inhibin Alpha (INHa)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibin Alpha (INHa)
TRV-0046091-03 200 µL

Polyclonal Antibody to Inhibin Alpha (INHa)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibin Alpha (INHa)
TRV-0046091-04 1 mL

Polyclonal Antibody to Inhibin Alpha (INHa)

Sign In for Pricing
View Details
Goat anti Human IgG IgA IgM (heavy and light chains), conjugated with TRITC
MBS571663-01 1 mL

Goat anti Human IgG IgA IgM (heavy and light chains), conjugated with TRITC

Sign In for Pricing
View Details