Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSPH Peptide - C-terminal region

PSPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSP, PSPase, AI480570

UniProt

Q99LS3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -Nedisertib
MQC54232-01 25 mg

(R) -Nedisertib

Sign In for Pricing
View Details
(R) -Nedisertib
MQC54232-02 50 mg

(R) -Nedisertib

Sign In for Pricing
View Details
(R) -Nedisertib
MQC54232-03 100 mg

(R) -Nedisertib

Sign In for Pricing
View Details
Goat Complement Component 7 ELISA Kit
MBS736004-01 48 Well

Goat Complement Component 7 ELISA Kit

Sign In for Pricing
View Details
Goat Complement Component 7 ELISA Kit
MBS736004-02 96 Well

Goat Complement Component 7 ELISA Kit

Sign In for Pricing
View Details
Goat Complement Component 7 ELISA Kit
MBS736004-03 5x 96 Well

Goat Complement Component 7 ELISA Kit

Sign In for Pricing
View Details