What is the catalog number for PSPH Peptide - C-terminal region?

The catalog number for PSPH Peptide - C-terminal region is orb1997567.

What sizes are available for PSPH Peptide - C-terminal region?

PSPH Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PSPH Peptide - C-terminal region in stock?

PSPH Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PSPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSP, PSPase, AI480570

UniProt

Q99LS3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598661.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SC216071 10 µg

RAB21 (NM_014999) Human 3' UTR Clone

Sign In for Pricing

View Details

ORF071806 1.0 µg DNA

Olr1142 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

E49Y6974 100 µL

Complement factor H Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

MR211765L4V 200 µL

Wdr35 (NM_172470) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

P507362 100 µg

PPY Protein (N-GST & C-His, Human)

Sign In for Pricing

View Details

HY-14283S 1 Each

Luliconazole-13C7

Sign In for Pricing

View Details