Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOLK Peptide - middle region

DOLK Peptide - middle region

Product Specifications

Product Name Alternative

Tmem15, BC026973, mKIAA1094

UniProt

Q8R2Y3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_808316.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LASVACLVVLYQNAKRSSSESKKHRAPTITRKYFHFIVVATYIPGIIFDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL
BNC402217-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF647 conjugate, 0.1mg/mL
BNC472556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ductless Fume Hood BFSD-503
BFSD-503 1 Unit

Ductless Fume Hood BFSD-503

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF640R conjugate, 0.1mg/mL
BNC401260-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Zyxin
Y058000 100 µL

Anti-Zyxin

Sign In for Pricing
View Details
Recombinant Rat Ifna2 Protein (Sumo Tag)
PDER100258-01 20 µg

Recombinant Rat Ifna2 Protein (Sumo Tag)

Sign In for Pricing
View Details