Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOLK Peptide - middle region

DOLK Peptide - middle region

Product Specifications

Product Name Alternative

Tmem15, BC026973, mKIAA1094

UniProt

Q8R2Y3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_808316.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LASVACLVVLYQNAKRSSSESKKHRAPTITRKYFHFIVVATYIPGIIFDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIK1 (NM_001010879) Human Over-expression Lysate
LC423204 20 µg

ZIK1 (NM_001010879) Human Over-expression Lysate

Sign In for Pricing
View Details
C9orf47 (NM_001142413) Human Over-expression Lysate
LY428076 100 µg

C9orf47 (NM_001142413) Human Over-expression Lysate

Sign In for Pricing
View Details
2,5-Dibromo-3,4-dinitrothiophene
TRC-D425435-2G 2 g

2,5-Dibromo-3,4-dinitrothiophene

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS804167 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS636641 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
MTUS1 (NM_001001931) Human Over-expression Lysate
LY424280 100 µg

MTUS1 (NM_001001931) Human Over-expression Lysate

Sign In for Pricing
View Details