Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL1 Peptide - middle region

MSL1 Peptide - middle region

Product Specifications

Product Name Alternative

Msl-1, AA682082, 2810017F12Rik, 4121402D02Rik, 4930463F05Rik

UniProt

Q6PDM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_082998.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSWRDHSVEPLRDPNPSDILENLDDSVFSKRHAKLELDEKRRKRWDIQRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GDA Rabbit Monoclonal Antibody
MA2788-.1 100 µL

Anti-GDA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PEX3 (NM_003630) Human Untagged Clone
SC117821 10 µg

PEX3 (NM_003630) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit Anti-Human EEF1B2 pAb
PA14944-01 50 μL

Rabbit Anti-Human EEF1B2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human EEF1B2 pAb
PA14944-02 100 μL

Rabbit Anti-Human EEF1B2 pAb

Sign In for Pricing
View Details
Rat Rgma Pre-designed siRNA Set B
SI211850B 1 Each

Rat Rgma Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Cadherin 12 (CDH12) ELISA Kit
GTR10369601 96 Well

Human Cadherin 12 (CDH12) ELISA Kit

Sign In for Pricing
View Details