Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUFM Peptide - middle region

TUFM Peptide - middle region

Product Specifications

Product Name Alternative

EFTU, C76308, C76389, EF-TuMT, 2300002G02Rik

UniProt

Q8BFR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELL2 (NM_001145107) Human Over-expression Lysate
LY428694 100 µg

NELL2 (NM_001145107) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF640R conjugate, 0.1mg/mL
BNC402221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse CCL5/RANTES Recombinant Rabbit monoclonal Antibody
HA725046 100 µL

Mouse CCL5/RANTES Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human OR7G1 activation kit by CRISPRa
GA114900 1 Kit

Human OR7G1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tceal8 (NM_025703) Mouse Tagged ORF Clone
MG200518 10 µg

Tceal8 (NM_025703) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Elab Fluor® 700 Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763M1-01 25 µg

Elab Fluor® 700 Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details