Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUFM Peptide - middle region

TUFM Peptide - middle region

Product Specifications

Product Name Alternative

EFTU, C76308, C76389, EF-TuMT, 2300002G02Rik

UniProt

Q8BFR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA2 Human Gene Knockout Kit (CRISPR)
KN204066BN 1 Kit

FOXA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)
KN202434RB 1 Kit

CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
General Serum Diluent, 2X
6709 1 L

General Serum Diluent, 2X

Sign In for Pricing
View Details
IL 32A Human
OM296570-01 10 µg

IL 32A Human

Sign In for Pricing
View Details
IL 32A Human
OM296570-02 2 µg

IL 32A Human

Sign In for Pricing
View Details
IL 32A Human
OM296570-03 1 mg

IL 32A Human

Sign In for Pricing
View Details