Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPBAR1 Peptide - middle region

GPBAR1 Peptide - middle region

Product Specifications

Product Name Alternative

BG37, GPCR, TGR5, M-BAR, GPR131

UniProt

Q80SS6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_778150.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRH2 (NM_005042) Human Recombinant Protein
TP310681 20 µg

PRH2 (NM_005042) Human Recombinant Protein

Sign In for Pricing
View Details
10?l tip box with ultra low retention tip BPIC-712
BPIC-712 1 Unit

10?l tip box with ultra low retention tip BPIC-712

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Rabbit monoclonal Antibody
HA750755 100 µL

Aldolase A/B/C Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Vmn1r222 Mouse Gene Knockout Kit (CRISPR)
KN519017 1 Kit

Vmn1r222 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beta III Tubulin Antibody
OC-1827-01 50 μL

Beta III Tubulin Antibody

Sign In for Pricing
View Details
Beta III Tubulin Antibody
OC-1827-02 100 µL

Beta III Tubulin Antibody

Sign In for Pricing
View Details