Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU3F1 Peptide - middle region

POU3F1 Peptide - middle region

Product Specifications

Product Name Alternative

Oct6, Otf6, Scip, Tst1, Oct-6, Otf-6, Test1, Tst-1

UniProt

P21952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM15 Human qPCR Primer Pair (NM_022115)
HP231907 200 Reactions

PRDM15 Human qPCR Primer Pair (NM_022115)

Sign In for Pricing
View Details
rac Xanthoanthrafil (>90%)
TRC-X500000-5MG 5 mg

rac Xanthoanthrafil (>90%)

Sign In for Pricing
View Details
Recombinant EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein / GP-RBD Protein (Fc Tag)
PKSV030135 100 µg

Recombinant EBOV (subtype Bundibugyo, strain Uganda 2007) Glycoprotein / GP-RBD Protein (Fc Tag)

Sign In for Pricing
View Details
I-Sydnocarb
TRC-S920005-5MG 5 mg

I-Sydnocarb

Sign In for Pricing
View Details
CF®498 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20997-50uL 1x 50 µL

CF®498 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]
AM12003FC-N 100 Tests

ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]

Sign In for Pricing
View Details