Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU3F1 Peptide - middle region

POU3F1 Peptide - middle region

Product Specifications

Product Name Alternative

Oct6, Otf6, Scip, Tst1, Oct-6, Otf-6, Test1, Tst-1

UniProt

P21952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 15 Rat
OM296720-01 1 mg

IL 15 Rat

Sign In for Pricing
View Details
IL 15 Rat
OM296720-02 10 µg

IL 15 Rat

Sign In for Pricing
View Details
IL 15 Rat
OM296720-03 2 µg

IL 15 Rat

Sign In for Pricing
View Details
17-Amino Geldanamycin
TRC-A609700-5MG 5 mg

17-Amino Geldanamycin

Sign In for Pricing
View Details
TM4SF19 (NM_138461) Human Recombinant Protein
TP322675M 100 µg

TM4SF19 (NM_138461) Human Recombinant Protein

Sign In for Pricing
View Details
(R)-Carnitine Hydrochloride 13C3
TRC-C184106-5MG 5 mg

(R)-Carnitine Hydrochloride 13C3

Sign In for Pricing
View Details