Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14A Peptide - middle region

CDC14A Peptide - middle region

Product Specifications

Product Name Alternative

Cdc14, CDC14A2, CDC14a1, A830059A17Rik

UniProt

Q6GQT0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5-isopropyl-1,3-phenylene) bis (methylsulfane)
OR1091618-01 250 mg

(5-isopropyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
(5-isopropyl-1,3-phenylene) bis (methylsulfane)
OR1091618-02 500 mg

(5-isopropyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
(5-isopropyl-1,3-phenylene) bis (methylsulfane)
OR1091618-03 1 g

(5-isopropyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
Mouse Interleukin 19 (IL19) ELISA Kit
MBS4500254-01 48 Tests

Mouse Interleukin 19 (IL19) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 19 (IL19) ELISA Kit
MBS4500254-02 96 Tests

Mouse Interleukin 19 (IL19) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 19 (IL19) ELISA Kit
MBS4500254-03 5x 96 Tests

Mouse Interleukin 19 (IL19) ELISA Kit

Sign In for Pricing
View Details