Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14A Peptide - middle region

CDC14A Peptide - middle region

Product Specifications

Product Name Alternative

Cdc14, CDC14A2, CDC14a1, A830059A17Rik

UniProt

Q6GQT0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC174 Pre-designed siRNA Set A
SI002335A 1 Each

Human CCDC174 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ValidElisa Kit
EK340533 96 Well

Human GP4/CD36 (Platelet Membrane Glycoprotein IV) ValidElisa Kit

Sign In for Pricing
View Details
1-Chloro-2,4-Dinitrobenzene 99% AR
00766 00025 25 g

1-Chloro-2,4-Dinitrobenzene 99% AR

Sign In for Pricing
View Details
Elo-6 Antibody
orb800048 2 mg

Elo-6 Antibody

Sign In for Pricing
View Details
GTSF1, ID (GTSF1, FAM112B, Gametocyte-specific factor 1, Protein FAM112B) (MaxLight 650) discontinued
036378-ML650 100 µL

GTSF1, ID (GTSF1, FAM112B, Gametocyte-specific factor 1, Protein FAM112B) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DRAM, CT (Damage-regulated autophagy modulator) (APC) discontinued
034796-APC 200 µL

DRAM, CT (Damage-regulated autophagy modulator) (APC) discontinued

Sign In for Pricing
View Details