Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAPBP Peptide - middle region

TAPBP Peptide - middle region

Product Specifications

Product Name Alternative

TPN, D17Wsu91e

UniProt

Q9R233

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033344.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPGLAGRMPPAQEKATAFAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound 0449-0080
orb1989784-01 1 mg

Compound 0449-0080

Sign In for Pricing
View Details
Compound 0449-0080
orb1989784-02 5 mg

Compound 0449-0080

Sign In for Pricing
View Details
(1S) -1- (thiophen-2-yl) ethan-1-amine hydrochloride
FCC71232-01 100 mg

(1S) -1- (thiophen-2-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
(1S) -1- (thiophen-2-yl) ethan-1-amine hydrochloride
FCC71232-02 1 g

(1S) -1- (thiophen-2-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
Anti-FABP1 Antibody
MBS821262-01 0.03 mL

Anti-FABP1 Antibody

Sign In for Pricing
View Details
Anti-FABP1 Antibody
MBS821262-02 0.05 mL

Anti-FABP1 Antibody

Sign In for Pricing
View Details