MEF2B Peptide - middle region
MEF2B Peptide - middle region
Product Specifications
Product Name Alternative
AI451606
UniProt
O55087
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEEGPEGPGE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6384645-01 0.1 mL
MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (FITC)
Sign In for Pricing
View Details 
MBS6384645-02 5x 0.1 mL
MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (FITC)
Sign In for Pricing
View Details 
H3892 96 Tests
Synaptic vesicle 2-Related protein (SVOP) Bovine ELISA Kit
Sign In for Pricing
View Details 