What is the catalog number for ATP6V0D2 Peptide - middle region?

The catalog number for ATP6V0D2 Peptide - middle region is orb1997551.

What sizes are available for ATP6V0D2 Peptide - middle region?

ATP6V0D2 Peptide - middle region is available in the following size(s): 100 µg.

Is ATP6V0D2 Peptide - middle region in stock?

ATP6V0D2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ATP6V0D2 Peptide - middle region

Product Specifications

Product Name Alternative

AI324824, V-ATPase, 1620401A02Rik

UniProt

Q80SY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_780615.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E43CP0236 500 µg

CD9 Recombinant Protein

Sign In for Pricing

View Details

sc-76406-V 200 µL

Rim4 shRNA (h) Lentiviral Particles

Sign In for Pricing

View Details

orb2114841 100 µL

ALDOA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

A01051-2-Dylight594 100 µg

Anti-LATS1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing

View Details

MBS6265876-01 0.1 mL

Green Fluorescent Protein (GFP) (BSA & Azide Free) (AP)

Sign In for Pricing

View Details

MBS6265876-02 5x 0.1 mL

Green Fluorescent Protein (GFP) (BSA & Azide Free) (AP)

Sign In for Pricing

View Details