Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V0D2 Peptide - middle region

ATP6V0D2 Peptide - middle region

Product Specifications

Product Name Alternative

AI324824, V-ATPase, 1620401A02Rik

UniProt

Q80SY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_780615.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK3 (NM_013253) Human Tagged ORF Clone Lentiviral Particle
RC200199L4V 200 µL

DKK3 (NM_013253) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti-Human HNRNPM pAb
PA15252-01 50 μL

Rabbit Anti-Human HNRNPM pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HNRNPM pAb
PA15252-02 100 μL

Rabbit Anti-Human HNRNPM pAb

Sign In for Pricing
View Details
NRCAM Polyclonal Antibody
MBS2574869-01 0.06 mL

NRCAM Polyclonal Antibody

Sign In for Pricing
View Details
NRCAM Polyclonal Antibody
MBS2574869-02 0.12 mL

NRCAM Polyclonal Antibody

Sign In for Pricing
View Details
NRCAM Polyclonal Antibody
MBS2574869-03 0.2 mL

NRCAM Polyclonal Antibody

Sign In for Pricing
View Details