HOXA6 Peptide - middle region
HOXA6 Peptide - middle region
Product Specifications
Product Name Alternative
Hox-1.2
UniProt
P09023
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034584.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
20170003-3 10 mL
GST-Tagged Recombinant Protein Purification Column
Sign In for Pricing
View Details MBS2120418-01 0.1 mL
APC-Linked Polyclonal Antibody to Desmocollin 1 (DSC1)
Sign In for Pricing
View Details MBS2120418-02 0.2 mL
APC-Linked Polyclonal Antibody to Desmocollin 1 (DSC1)
Sign In for Pricing
View Details MBS2120418-03 0.5 mL
APC-Linked Polyclonal Antibody to Desmocollin 1 (DSC1)
Sign In for Pricing
View Details MBS2120418-04 1 mL
APC-Linked Polyclonal Antibody to Desmocollin 1 (DSC1)
Sign In for Pricing
View Details