Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA6 Peptide - middle region

HOXA6 Peptide - middle region

Product Specifications

Product Name Alternative

Hox-1.2

UniProt

P09023

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSF1L (NM_001008901) Human Over-expression Lysate
LS149699 100 µg

GTSF1L (NM_001008901) Human Over-expression Lysate

Sign In for Pricing
View Details
AHNAK2 (Protein AHNAK2, C14orf78, KIAA2019) (FITC)
124076-FITC 100 µL

AHNAK2 (Protein AHNAK2, C14orf78, KIAA2019) (FITC)

Sign In for Pricing
View Details
Lentiviral human C3orf62 shRNA (UAS) - Lentiviral human C3orf62 shRNA (UAS, RFP) plasmid
GTR15115969 1 Vial

Lentiviral human C3orf62 shRNA (UAS) - Lentiviral human C3orf62 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
FRS3
316454 100 µL

FRS3

Sign In for Pricing
View Details
FEOM3 3'UTR Luciferase Stable Cell Line
TU007885 1.0 mL

FEOM3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C7orf11 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV813199 1.0 µg DNA

C7orf11 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details