Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Peptide - middle region

SUMF1 Peptide - middle region

Product Specifications

Product Name Alternative

FGE, AA543204, AI463102, AI851573

UniProt

Q8R0F3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666049.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYCTWAGKRLPTEAEWEYSCRGGLQNRLFPWGNKLQPKGQHYANIWQGKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toyocamycin
C02095-5mg 5 mg

Toyocamycin

Sign In for Pricing
View Details
Human aFP (Alpha-Fetoprotein) ELISA Kit
MBS8800303-01 48 Well

Human aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Human aFP (Alpha-Fetoprotein) ELISA Kit
MBS8800303-02 96 Well

Human aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Human aFP (Alpha-Fetoprotein) ELISA Kit
MBS8800303-03 5x 96 Well

Human aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Human aFP (Alpha-Fetoprotein) ELISA Kit
MBS8800303-04 10x 96 Well

Human aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
SH3TC2 Antibody
MBS7120899-01 0.05 mg

SH3TC2 Antibody

Sign In for Pricing
View Details