Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Peptide - middle region

SUMF1 Peptide - middle region

Product Specifications

Product Name Alternative

FGE, AA543204, AI463102, AI851573

UniProt

Q8R0F3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666049.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYCTWAGKRLPTEAEWEYSCRGGLQNRLFPWGNKLQPKGQHYANIWQGKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-SPE39 Antibody
MBS4507531-01 0.05 mL

Rabbit anti-SPE39 Antibody

Sign In for Pricing
View Details
Rabbit anti-SPE39 Antibody
MBS4507531-02 0.1 mL

Rabbit anti-SPE39 Antibody

Sign In for Pricing
View Details
Rabbit anti-SPE39 Antibody
MBS4507531-03 5x 0.1 mL

Rabbit anti-SPE39 Antibody

Sign In for Pricing
View Details
NCBP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2473562 100 µL

NCBP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
MLLT10 (Protein AF-10, Myeloid/Lymphoid or Mixed-Lineage Leukemia; Translocated to, 10)
485897 100 µL

MLLT10 (Protein AF-10, Myeloid/Lymphoid or Mixed-Lineage Leukemia; Translocated to, 10)

Sign In for Pricing
View Details
5-Fluorodihydropyrimidine-2,4-dione
276360-01 10 mg

5-Fluorodihydropyrimidine-2,4-dione

Sign In for Pricing
View Details