What is the catalog number for NFIX Peptide - middle region?

The catalog number for NFIX Peptide - middle region is orb1997544.

What sizes are available for NFIX Peptide - middle region?

NFIX Peptide - middle region is available in the following size(s): 100 µg.

Is NFIX Peptide - middle region in stock?

NFIX Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NFIX Peptide - middle region

Product Specifications

Product Name Alternative

CTF, NF1-X, NFI-X, NF-I/X

UniProt

P70257

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001075451.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QZB52881-01 0.5 g

4- (3-Cyclopropyl-1H-1,2,4-triazol-5-yl) aniline

Sign In for Pricing

View Details

QZB52881-02 5 g

4- (3-Cyclopropyl-1H-1,2,4-triazol-5-yl) aniline

Sign In for Pricing

View Details

GTR10315196 96 Well

Canine Retinoic acid receptor RXR gamma (RXRG) ELISA Kit

Sign In for Pricing

View Details

OAAD00069-200UG 0.2 mg

ST6GAL1 Antibody

Sign In for Pricing

View Details

LV775623 1.0 µg DNA

RPL7P10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing

View Details

sc-436345-ACT-2 20 µg

Integrin αD CRISPR Activation Plasmid (m2)

Sign In for Pricing

View Details