Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDAC3 Peptide - N-terminal region

VDAC3 Peptide - N-terminal region

Product Specifications

UniProt

Q60931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCL2 Antibody
MBS415359-01 0.1 mL

Anti-CCL2 Antibody

Sign In for Pricing
View Details
Anti-CCL2 Antibody
MBS415359-02 5x 0.1 mL

Anti-CCL2 Antibody

Sign In for Pricing
View Details
Rwdd3 Mouse shRNA Lentiviral Particle (Locus ID 73170)
TL509459V 500 µL Each

Rwdd3 Mouse shRNA Lentiviral Particle (Locus ID 73170)

Sign In for Pricing
View Details
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (MaxLight 650) discontinued
249681-ML650 100 µL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Adiponectin (ADP) ELISA Kit
DL-ADP-Mu-01 48 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
Mouse Adiponectin (ADP) ELISA Kit
DL-ADP-Mu-02 96 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details