Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDAC3 Peptide - N-terminal region

VDAC3 Peptide - N-terminal region

Product Specifications

UniProt

Q60931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPX Recombinant Protein Antigen
NBP2-48558PEP 0.1 mL

RIPX Recombinant Protein Antigen

Sign In for Pricing
View Details
Trophinin (Tro) Mouse Gene Knockout Kit (CRISPR)
KN518275 1 Kit

Trophinin (Tro) Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody
orb5180-01 50 μL

Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody
orb5180-02 100 µL

Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody
orb5180-03 200 µL

Phospho-MAPK3 (Tyr204) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human GCM2 Polyclonal Antibody
PHB26201 100 μg

Anti-Human GCM2 Polyclonal Antibody

Sign In for Pricing
View Details