Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA2B Peptide - middle region

ITGA2B Peptide - middle region

Product Specifications

Product Name Alternative

CD41, CD41B, GpIIb, AI172977, alphaIIb

UniProt

Q9QUM0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034705.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)
MBS2051684-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1)

Sign In for Pricing
View Details