Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN11 Peptide - middle region

CLDN11 Peptide - middle region

Product Specifications

Product Name Alternative

Osp, Otm, Claudin11, Claudin-11

UniProt

Q60771

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032796.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTRK3 Rabbit pAb
E2505842 100 µL

NTRK3 Rabbit pAb

Sign In for Pricing
View Details
TRIM2 Antibody, Biotin conjugated
MBS1494025-01 0.05 mg

TRIM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRIM2 Antibody, Biotin conjugated
MBS1494025-02 0.1 mg

TRIM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRIM2 Antibody, Biotin conjugated
MBS1494025-03 5x 0.1 mg

TRIM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human DNMT3L shRNA (UAS) - Lentiviral human DNMT3L shRNA (UAS, GFP) (25)
GTR15086756 1 Vial

Lentiviral human DNMT3L shRNA (UAS) - Lentiviral human DNMT3L shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Adtrp qPCR Primer Pair
QM50954S 200 Tests

Mouse Adtrp qPCR Primer Pair

Sign In for Pricing
View Details