CLDN11 Peptide - middle region
CLDN11 Peptide - middle region
Product Specifications
Product Name Alternative
Osp, Otm, Claudin11, Claudin-11
UniProt
Q60771
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032796.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7251212-01 48 Well
Rabbit B-cell antigen receptor complex-associated protein alpha chain (CD79A) ELISA Kit
Sign In for Pricing
View Details MBS7251212-02 96 Well
Rabbit B-cell antigen receptor complex-associated protein alpha chain (CD79A) ELISA Kit
Sign In for Pricing
View Details MBS7251212-03 5x 96 Well
Rabbit B-cell antigen receptor complex-associated protein alpha chain (CD79A) ELISA Kit
Sign In for Pricing
View Details MBS7251212-04 10x 96 Well
Rabbit B-cell antigen receptor complex-associated protein alpha chain (CD79A) ELISA Kit
Sign In for Pricing
View Details