KAT2B Peptide - N-terminal region
KAT2B Peptide - N-terminal region
Product Specifications
Product Name Alternative
Pcaf, p/CAF, AI461839, AW536563, A930006P13Rik
UniProt
Q9JHD1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_064389.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2036580-01 0.1 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details MBS2036580-02 0.2 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details MBS2036580-03 0.5 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details MBS2036580-04 1 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details MBS2036580-05 5 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details MBS2036580-06 5x 5 mL
HRP-Linked Polyclonal Antibody to Interleukin 18 (IL18)
Sign In for Pricing
View Details