KAT2B Peptide - N-terminal region
KAT2B Peptide - N-terminal region
Product Specifications
Product Name Alternative
Pcaf, p/CAF, AI461839, AW536563, A930006P13Rik
UniProt
Q9JHD1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_064389.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9398980 Inquire
Goose Uncharacterized Protein C6orf132 (C6ORF132) ELISA Kit
Sign In for Pricing
View Details 247213-FITC 100 µL
HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (FITC)
Sign In for Pricing
View Details ARP62610_P050-Biotin 100 µL
BZW1 Antibody - C-terminal region : Biotin (ARP62610_P050-Biotin)
Sign In for Pricing
View Details