FUT1 Peptide - C-terminal region
FUT1 Peptide - C-terminal region
Product Specifications
UniProt
O09160
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details