SPC25 Peptide - C-terminal region
SPC25 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Spbc25, 2600017H08Rik, 2610205L13Rik
UniProt
Q3UA16
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001186052.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTNNFSAFLANIRKAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6366000-01 0.2 mL
ZNF252, NT (Zinc finger protein 252,ZNF252,) (FITC)
Sign In for Pricing
View Details MBS6366000-02 5x 0.2 mL
ZNF252, NT (Zinc finger protein 252,ZNF252,) (FITC)
Sign In for Pricing
View Details 
bs-9333R-APC-Cy5.5 100 µL
NHLRC3 Polyclonal Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details K0222804 1.0 µg DNA
C2orf27A sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details