What is the catalog number for SPC25 Peptide - C-terminal region?

The catalog number for SPC25 Peptide - C-terminal region is orb1997535.

What sizes are available for SPC25 Peptide - C-terminal region?

SPC25 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is SPC25 Peptide - C-terminal region in stock?

SPC25 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SPC25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Spbc25, 2600017H08Rik, 2610205L13Rik

UniProt

Q3UA16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTNNFSAFLANIRKAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-11498JF549 0.1 mL

Mouse Monoclonal Nucleolin Antibody (SPM614) [Janelia Fluor 549]

Sign In for Pricing

View Details

N0874-01 40 µL

c-JUN Antibody

Sign In for Pricing

View Details

N0874-02 100 µL

c-JUN Antibody

Sign In for Pricing

View Details

N0874-03 200 µL

c-JUN Antibody

Sign In for Pricing

View Details

sc-137092 AF790 200 µg/mL

TCP-1 δ (H-1) Alexa Fluor® 790

Sign In for Pricing

View Details

501619 200 µL

ETFA, ID

Sign In for Pricing

View Details