GAMT Peptide - middle region
GAMT Peptide - middle region
Product Specifications
Product Name Alternative
Spintz1, AA571402
UniProt
O35969
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034385.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APTLPDGHFDGILYDTYPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2921841-01 20 µg
Recombinant Salmonella schwarzengrund Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
Sign In for Pricing
View Details orb2921841-02 100 µg
Recombinant Salmonella schwarzengrund Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
Sign In for Pricing
View Details 
K0157205 3x 1.0 µg
ATRIP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details