Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO3 Peptide - middle region

ENO3 Peptide - middle region

Product Specifications

Product Name Alternative

MSE, Eno-3

UniProt

P21550

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129534.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKNFIQNYPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isozeaxanthin
TRC-I918465-1MG 1 mg

Isozeaxanthin

Sign In for Pricing
View Details
4-Chloro-N-[2-(4-hydroxyphenyl)ethyl]benzamide-d4
TRC-C366662-2MG 2 mg

4-Chloro-N-[2-(4-hydroxyphenyl)ethyl]benzamide-d4

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702958 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS627259 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
GABRP Human Gene Knockout Kit (CRISPR)
KN224902LP 1 Kit

GABRP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apol11a Mouse Gene Knockout Kit (CRISPR)
KN501426 1 Kit

Apol11a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details