Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO3 Peptide - middle region

ENO3 Peptide - middle region

Product Specifications

Product Name Alternative

MSE, Eno-3

UniProt

P21550

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129534.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKNFIQNYPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD62E Recombinant Rabbit monoclonal Antibody
HA723636 100 µL

Human CD62E Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL
BNC881025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4 -diazepine, Hydrochloride
TRC-I715000-10MG 10 mg

1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4 -diazepine, Hydrochloride

Sign In for Pricing
View Details
TentaGel® S NHS Ester
S30135.1G 1 g

TentaGel® S NHS Ester

Sign In for Pricing
View Details
COX4I1 Rabbit Monoclonal Antibody [Clone ID: 23GB775]
TA424674 100 µL

COX4I1 Rabbit Monoclonal Antibody [Clone ID: 23GB775]

Sign In for Pricing
View Details
RPS4Y1 Antibody
8C14122-AAT 50 µg

RPS4Y1 Antibody

Sign In for Pricing
View Details